PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10032816m
Common NameCICLE_v10032816mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 195aa    MW: 21800.2 Da    PI: 9.5598
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10032816mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048e-33115173159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+
  Ciclev10032816m 115 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHP 173
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.3E-34100173IPR003657WRKY domain
SuperFamilySSF1182901.09E-29107174IPR003657WRKY domain
PROSITE profilePS5081130.125110175IPR003657WRKY domain
SMARTSM007741.1E-38115174IPR003657WRKY domain
PfamPF031061.5E-26116173IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MENYQTYFPT AAAAAAAACS SSASLDRMNN SNSNAEFQGY NDHKPSGFLG LLSGMEVNPA  60
AASLNGDGNI NSENKSFTNN IGSENGEKMG KIKKGEKKVR KPRYAFQTRS QVDILDDGYR  120
WRKYGQKAVK NNKFPRSYYR CTHQGCNVKK QVQRLTKDEG VVVTTYEGMH SHPIERSTDN  180
FEHILNQMQI YTSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-28105174776Probable WRKY transcription factor 4
2lex_A4e-28105174776Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437986.11e-147hypothetical protein CICLE_v10032816mg
RefseqXP_006484154.11e-147PREDICTED: probable WRKY transcription factor 75
TrEMBLV4TN361e-146V4TN36_9R
STRINGPOPTR_0003s16750.18e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.14e-59WRKY DNA-binding protein 75